PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102026001
Common NameGSBRNA2T00102026001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 360aa    MW: 39863.6 Da    PI: 8.676
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102026001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32213268156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00102026001 213 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 268
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-28210271IPR009057Homeodomain-like
SuperFamilySSF466898.69E-18210271IPR009057Homeodomain-like
PROSITE profilePS5129415.204210270IPR017930Myb domain
TIGRFAMsTIGR015571.4E-26213268IPR006447Myb domain, plants
PfamPF002495.7E-8215266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MMVQKMEVDH AHKMQRCHEY VEALKEEQKK IQVFQRELPL CLELVTQAIE ACKKELSVTS  60
TTSEQYSEQT ASVCGGPVLE EFIPIKKSNN EENGEHESPR EVDKSDVDSK KSDWLRSAHL  120
WNHHSQDPDM TVVVAKKARV VEVKPNSHNR GGFQPFQKEK KRVFSETDLH PAVKATTPAP  180
ATTTCSTTEV GGADKAGEEQ IQKQQLQTQT QRKQRRCWSP ELHRRFLHAL QQLGGSHVAT  240
PKQIRDHMKV DGLTNDEVKS HLQKYRLHTR RPATAQGNGN SQQPQFVVVG GIWVPSPQDF  300
PPPSDVANKG DGVYAQATAQ APVAPQSPKR SVERSSGRCN SPAASSSTNT TTTSASPVS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.82740.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102026001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105417.10.0PREDICTED: uncharacterized protein LOC103831280
TrEMBLA0A078E9F10.0A0A078E9F1_BRANA; BnaA07g27330D protein
STRINGBra004330.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-106G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]